PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G77080.5
Common NameAGL27, FLM, MAF1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 173aa    MW: 19786.6 Da    PI: 6.3012
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G77080.5genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.47e-22956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krienks rqvtfskRrng++ KA  LS+LC+  vav+++s +gkly+
  AT1G77080.5  9 KRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYD 56
                 79********************************************97 PP

2K-box387.1e-14951652999
        K-box  29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  e L++ q +l   ++++ s+  L +Le+qLe++l+  R++K el++e ie l++kek l+een+ L ++l 
  AT1G77080.5  95 ELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQLS 165
                  556666677777788999************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.05E-25173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.202161IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-33160IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-23323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-211055IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.32280170IPR002487Transcription factor, K-box
PfamPF014862.3E-1195164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006340anatomyadult vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA SGKLYDSSSG  60
DDISKIIDRY EIQHADELRA LDLEEKIQNY LPHKELLETV QSKLEEPNVD NVSVDSLISL  120
EEQLETALSV SRARKAELMM EYIESLKEKE KLLREENQVL ASQLSEKKGM SHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-15270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.492251e-156bud| flower| inflorescence| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264949_at1e-77
Expression AtlasAT1G77080-
AtGenExpressAT1G77080-
ATTED-IIAT1G77080-
Functional Description ? help Back to Top
Source Description
TAIRMADS domain protein - flowering regulator that is closely related to FLC. Deletion of this locus in Nd ecotype is correlated with earlier flowering in short days suggesting function as a negative regulator of flowering.
Function -- GeneRIF ? help Back to Top
  1. Our studies provide insight into the role of MPF2-like genes in phase transition by interacting with SOC1 and MAF1 genes, thereby also pointing to their significance as potential candidates for modifying flowering in crop plants in the future.
    [PMID: 22539207]
  2. Control of SVP-FLM-beta repressor complex abundance via transcriptional and splicing regulation of FLM and posttranslational regulation of SVP protein stability provides an efficient, rapid mechanism for plants to respond to ambient temperature changes.
    [PMID: 24030492]
  3. SVP-FLM-beta complex is predominately formed at low temperatures and prevents precocious flowering; by contrast, the competing SVP-FLM-delta complex is impaired in DNA binding and acts as a dominant-negative activator of flowering at higher temperatures
    [PMID: 24067612]
  4. FLM and MAF2 repress flowering in parallel at low temperature.
    [PMID: 25955034]
  5. we identify insertion polymorphisms in the first intron of FLM as causative for accelerated flowering in many natural A. thaliana accessions, especially in cool (15 degrees C) temperatures
    [PMID: 26492483]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00105ChIP-seq26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G77080.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G77080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3126650.0AF312665.1 Arabidopsis thaliana MADS-box protein AGL27-I (AGL27) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974160.21e-120agamous-like MADS-box protein AGL27
SwissprotQ9AT761e-113AGL27_ARATH; Agamous-like MADS-box protein AGL27
TrEMBLC0J8J76e-94C0J8J7_ARATH; MAF3
STRINGAT1G77080.41e-111(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes.
    Plant J., 2000. 24(4): p. 457-66
    [PMID:11115127]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Ratcliffe OJ,Nadzan GC,Reuber TL,Riechmann JL
    Regulation of flowering in Arabidopsis by an FLC homologue.
    Plant Physiol., 2001. 126(1): p. 122-32
    [PMID:11351076]
  4. Scortecci KC,Michaels SD,Amasino RM
    Identification of a MADS-box gene, FLOWERING LOCUS M, that represses flowering.
    Plant J., 2001. 26(2): p. 229-36
    [PMID:11389763]
  5. Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF
    APETALA1 and SEPALLATA3 interact to promote flower development.
    Plant J., 2001. 26(4): p. 385-94
    [PMID:11439126]
  6. Michaels SD, et al.
    AGL24 acts as a promoter of flowering in Arabidopsis and is positively regulated by vernalization.
    Plant J., 2003. 33(5): p. 867-74
    [PMID:12609028]
  7. Scortecci K,Michaels SD,Amasino RM
    Genetic interactions between FLM and other flowering-time genes in Arabidopsis thaliana.
    Plant Mol. Biol., 2003. 52(5): p. 915-22
    [PMID:14558654]
  8. Oh S,Zhang H,Ludwig P,van Nocker S
    A mechanism related to the yeast transcriptional regulator Paf1c is required for expression of the Arabidopsis FLC/MAF MADS box gene family.
    Plant Cell, 2004. 16(11): p. 2940-53
    [PMID:15472079]
  9. Doyle MR, et al.
    HUA2 is required for the expression of floral repressors in Arabidopsis thaliana.
    Plant J., 2005. 41(3): p. 376-85
    [PMID:15659097]
  10. Werner JD, et al.
    Quantitative trait locus mapping and DNA array hybridization identify an FLM deletion as a cause for natural flowering-time variation.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(7): p. 2460-5
    [PMID:15695584]
  11. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  12. Lehti-Shiu MD,Adamczyk BJ,Fernandez DE
    Expression of MADS-box genes during the embryonic phase in Arabidopsis.
    Plant Mol. Biol., 2005. 58(1): p. 89-107
    [PMID:16028119]
  13. Kim SY, et al.
    Establishment of the vernalization-responsive, winter-annual habit in Arabidopsis requires a putative histone H3 methyl transferase.
    Plant Cell, 2005. 17(12): p. 3301-10
    [PMID:16258034]
  14. Balasubramanian S,Sureshkumar S,Lempe J,Weigel D
    Potent induction of Arabidopsis thaliana flowering by elevated growth temperature.
    PLoS Genet., 2006. 2(7): p. e106
    [PMID:16839183]
  15. Sung S,Schmitz RJ,Amasino RM
    A PHD finger protein involved in both the vernalization and photoperiod pathways in Arabidopsis.
    Genes Dev., 2006. 20(23): p. 3244-8
    [PMID:17114575]
  16. Li Y,Roycewicz P,Smith E,Borevitz JO
    Genetics of local adaptation in the laboratory: flowering time quantitative trait loci under geographic and seasonal conditions in Arabidopsis.
    PLoS ONE, 2006. 1: p. e105
    [PMID:17205109]
  17. Kuhn JM,Breton G,Schroeder JI
    mRNA metabolism of flowering-time regulators in wild-type Arabidopsis revealed by a nuclear cap binding protein mutant, abh1.
    Plant J., 2007. 50(6): p. 1049-62
    [PMID:17488241]
  18. Andersson CR, et al.
    The FLX gene of Arabidopsis is required for FRI-dependent activation of FLC expression.
    Plant Cell Physiol., 2008. 49(2): p. 191-200
    [PMID:18156133]
  19. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  20. Pouteau S, et al.
    Diversification of photoperiodic response patterns in a collection of early-flowering mutants of Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1465-73
    [PMID:18799658]
  21. Mathieu J,Yant LJ,Mürdter F,Küttner F,Schmid M
    Repression of flowering by the miR172 target SMZ.
    PLoS Biol., 2009. 7(7): p. e1000148
    [PMID:19582143]
  22. Balasubramanian S,Weigel D
    Temperature Induced Flowering in Arabidopsis thaliana.
    Plant Signal Behav, 2006. 1(5): p. 227-8
    [PMID:19704664]
  23. Laluk K,Mengiste T
    The Arabidopsis extracellular UNUSUAL SERINE PROTEASE INHIBITOR functions in resistance to necrotrophic fungi and insect herbivory.
    Plant J., 2011. 68(3): p. 480-94
    [PMID:21749505]
  24. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  25. Yun JY,Tamada Y,Kang YE,Amasino RM
    Arabidopsis trithorax-related3/SET domain GROUP2 is required for the winter-annual habit of Arabidopsis thaliana.
    Plant Cell Physiol., 2012. 53(5): p. 834-46
    [PMID:22378382]
  26. Khan MR,Khan IU,Ali GM
    MPF2-like MADS-box genes affecting expression of SOC1 and MAF1 are recruited to control flowering time.
    Mol. Biotechnol., 2013. 54(1): p. 25-36
    [PMID:22539207]
  27. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  28. Lee JH, et al.
    Regulation of temperature-responsive flowering by MADS-box transcription factor repressors.
    Science, 2013. 342(6158): p. 628-32
    [PMID:24030492]
  29. Pos
    Temperature-dependent regulation of flowering by antagonistic FLM variants.
    Nature, 2013. 503(7476): p. 414-7
    [PMID:24067612]
  30. Hwan Lee J,Sook Chung K,Kim SK,Ahn JH
    Post-translational regulation of short vegetative phase as a major mechanism for thermoregulation of flowering.
    Plant Signal Behav, 2014. 9(3): p. e28193
    [PMID:24614351]
  31. Airoldi CA,McKay M,Davies B
    MAF2 Is Regulated by Temperature-Dependent Splicing and Represses Flowering at Low Temperatures in Parallel with FLM.
    PLoS ONE, 2015. 10(5): p. e0126516
    [PMID:25955034]
  32. Lutz U, et al.
    Modulation of Ambient Temperature-Dependent Flowering in Arabidopsis thaliana by Natural Variation of FLOWERING LOCUS M.
    PLoS Genet., 2015. 11(10): p. e1005588
    [PMID:26492483]